SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g18520

Feature Type:gene_model
Chromosome:Gm04
Start:20218570
stop:20220620
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g18520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45690AT Annotation by Michelle Graham. TAIR10: shrunken seed protein (SSE1) | chr2:18823465-18825601 REVERSE LENGTH=367 SoyBaseE_val: 5.00E-48ISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0007031GO-bp Annotation by Michelle Graham. GO Biological Process: peroxisome organization SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13299Panther UNCHARACTERIZED JGI ISS
PF08610PFAM Peroxisomal membrane protein (Pex16) JGI ISS
UniRef100_I1JW55UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW55_SOYBN SoyBaseE_val: 1.00E-81ISS
UniRef100_Q8S8S1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxisome biogenesis protein 16 n=1 Tax=Arabidopsis thaliana RepID=PEX16_ARATH SoyBaseE_val: 3.00E-45ISS

Expression Patterns of Glyma04g18520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g18520 not represented in the dataset
Glyma04g18520 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g18520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g148600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g18520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g18520
>Glyma04g18520.1   sequence type=CDS   gene model=Glyma04g18520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGTTAAACATTAGACCACTTATTTATGTTTTATTTATTGGAAAATATGGTATTCGATCATGGACCCCTTGGTTCCTTTTGCTGGCTATTGATTGCATAGGAAACAGTATTCTTTCACTCATTACATCGTTAGTGGCTGGTGGGAAGGACCGAATGTTTCATCTGTCTGCCCCAGAAAAGGATGAGGTTAAACGGCGAAAGCTACTATTTGTTCTTTACCTAATGAGAGATCCATTTTTCAGCAAGTATACTAGGCAAAGAATTGAAAGCACGGAGAAAGTTTTGGAGCCTATTCCTGTCATAGGATTTCTCACAGCAAAACTTGTTGAACTTATAATTGGAGCTCAAACACGATACACTTACATGTCAGGATCGTGA
Predicted protein sequences of Glyma04g18520
>Glyma04g18520.1   sequence type=predicted peptide   gene model=Glyma04g18520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMLNIRPLIYVLFIGKYGIRSWTPWFLLLAIDCIGNSILSLITSLVAGGKDRMFHLSAPEKDEVKRRKLLFVLYLMRDPFFSKYTRQRIESTEKVLEPIPVIGFLTAKLVELIIGAQTRYTYMSGS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo